Human HBZ protein

Catalog Number: BYT-ORB54415
Article Name: Human HBZ protein
Biozol Catalog Number: BYT-ORB54415
Supplier Catalog Number: orb54415
Alternative Catalog Number: BYT-ORB54415-20,BYT-ORB54415-100,BYT-ORB54415-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: HBAZ Hemoglobin zeta chain Zeta-globin
This Human HBZ protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 42.5 kDa
UniProt: P02008
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-252AA: 1-142AAFull Length of Isoform 2 : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.