Human QKI protein

Catalog Number: BYT-ORB54422
Article Name: Human QKI protein
Biozol Catalog Number: BYT-ORB54422
Supplier Catalog Number: orb54422
Alternative Catalog Number: BYT-ORB54422-20,BYT-ORB54422-100,BYT-ORB54422-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DKFZp586I0923, HKQ, Homolog of mouse quaking QKI KH domain RNA binding protein, Hqk, HQK1, HqkI, OTTHUMP00000017581, OTTHUMP00000017582, OTTHUMP00000017583, Protein quaking, QK, QK1, QK3, QKI, QKI_HUMAN, QKI1, Quaking homolog, Quaking homolog KH domain RNA binding, Quaking homolog KH domain RNA binding mouse, Quaking isoform 1, Quaking protein, RNA binding protein HQK
This Human QKI protein spans the amino acid sequence from region 1-341aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 64.7 kDa
UniProt: Q96PU8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLI
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-318AA: 1-341AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.