Human RAE1 protein

Catalog Number: BYT-ORB54423
Article Name: Human RAE1 protein
Biozol Catalog Number: BYT-ORB54423
Supplier Catalog Number: orb54423
Alternative Catalog Number: BYT-ORB54423-20,BYT-ORB54423-100,BYT-ORB54423-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Rae1 protein homolog mRNA-associated protein mrnp 41
This Human RAE1 protein spans the amino acid sequence from region 1-368aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 68 kDa
UniProt: P78406
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-341AA: 1-368AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.