Human RALB protein

Catalog Number: BYT-ORB54437
Article Name: Human RALB protein
Biozol Catalog Number: BYT-ORB54437
Supplier Catalog Number: orb54437
Alternative Catalog Number: BYT-ORB54437-20,BYT-ORB54437-100,BYT-ORB54437-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 5730472O18Rik, dRalb, GTP binding protein, Ralb, RALB_HUMAN, RAS like protein B, RAS like proto oncogene B, Ras related GTP binding protein B, Ras-related protein Ral-B, v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein), v ral simian leukemia viral oncogene homolog B (ras related), V ral simian leukemia viral oncogene homolog B
This Human RALB protein spans the amino acid sequence from region 1-206aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 50.1 kDa
UniProt: P11234
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-382AA: 1-206AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.