Human RASSF5 protein

Catalog Number: BYT-ORB54447
Article Name: Human RASSF5 protein
Biozol Catalog Number: BYT-ORB54447
Supplier Catalog Number: orb54447
Alternative Catalog Number: BYT-ORB54447-20,BYT-ORB54447-100,BYT-ORB54447-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues
This Human RASSF5 protein spans the amino acid sequence from region 1-265aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 57.4 kDa
UniProt: Q8WWW0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-205AA: 1-265AAFull Length : Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.