Human RGS5 protein

Catalog Number: BYT-ORB54448
Article Name: Human RGS5 protein
Biozol Catalog Number: BYT-ORB54448
Supplier Catalog Number: orb54448
Alternative Catalog Number: BYT-ORB54448-20,BYT-ORB54448-100,BYT-ORB54448-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129, Regulator of G Protein Signalling 5, Regulator of G-protein signaling 5, RGS 5, RGS5, RGS5_HUMAN
This Human RGS5 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 47.9 kDa
UniProt: O15539
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-265AA: 1-181AAFull Length of Isoform 2 : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.