Human TP53AIP1 protein

Catalog Number: BYT-ORB54455
Article Name: Human TP53AIP1 protein
Biozol Catalog Number: BYT-ORB54455
Supplier Catalog Number: orb54455
Alternative Catalog Number: BYT-ORB54455-20,BYT-ORB54455-100,BYT-ORB54455-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: p53 regulated apoptosis inducing protein 1, p53-regulated apoptosis-inducing protein 1, P53AIP 1, p53AIP1, TP53AIP 1, TP53AIP1, TPIP1_HUMAN
This Human TP53AIP1 protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 38.3 kDa
UniProt: Q9HCN2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-147AA: 1-108AAFull Length : Full Length of BC069399
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.