Human U2AF1L4 protein

Catalog Number: BYT-ORB54460
Article Name: Human U2AF1L4 protein
Biozol Catalog Number: BYT-ORB54460
Supplier Catalog Number: orb54460
Alternative Catalog Number: BYT-ORB54460-20,BYT-ORB54460-100,BYT-ORB54460-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: U2 auxiliary factor 26 U2 small nuclear RNA auxiliary factor 1-like protein 4
This Human U2AF1L4 protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 49 kDa
UniProt: Q8WU68
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-149AA: 1-202AAFull Length : Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.