Human PDCD2L protein

Catalog Number: BYT-ORB54463
Article Name: Human PDCD2L protein
Biozol Catalog Number: BYT-ORB54463
Supplier Catalog Number: orb54463
Alternative Catalog Number: BYT-ORB54463-20,BYT-ORB54463-100,BYT-ORB54463-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: PDCD2L, Programmed cell death protein 2-like
This Human PDCD2L protein spans the amino acid sequence from region 1-358aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 66.3 kDa
UniProt: Q9BRP1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-165AA: 1-358AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.