Human EEF1B2 protein

Catalog Number: BYT-ORB54499
Article Name: Human EEF1B2 protein
Biozol Catalog Number: BYT-ORB54499
Supplier Catalog Number: orb54499
Alternative Catalog Number: BYT-ORB54499-20,BYT-ORB54499-100,BYT-ORB54499-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: EEF1B, EEF1B1, EEF1B2, EF-1-beta, EF1B, EF1B_HUMAN, Elongation factor 1, beta-2-A, Elongation factor 1-beta, eukaryotic translation elongation factor 1 beta 1, eukaryotic translation elongation factor 1 beta 2
This Human EEF1B2 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51.8 kDa
UniProt: P24534
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-Trx-tagged: N-terminal GST-tagged1-100AA: 1-225AAFull Length of Isoform 2 : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.