Human CETN3 protein

Catalog Number: BYT-ORB54517
Article Name: Human CETN3 protein
Biozol Catalog Number: BYT-ORB54517
Supplier Catalog Number: orb54517
Alternative Catalog Number: BYT-ORB54517-20,BYT-ORB54517-100,BYT-ORB54517-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CDC31 homolog, CEN 3, CEN3, Centrin EF hand protein 3, Centrin-3, Centrin3, CETN 3, Cetn3, CETN3_HUMAN, EF hand superfamily member, MGC12502, MGC138245
This Human CETN3 protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 46.5 kDa
UniProt: O15182
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-172AA: 1-167AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.