Human MRPS16 protein

Catalog Number: BYT-ORB54530
Article Name: Human MRPS16 protein
Biozol Catalog Number: BYT-ORB54530
Supplier Catalog Number: orb54530
Alternative Catalog Number: BYT-ORB54530-20,BYT-ORB54530-100,BYT-ORB54530-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 28S ribosomal protein S16, 28S ribosomal protein S16 mitochondrial, CGI-132, COXPD2, mitochondrial, Mitochondrial ribosomal protein S16, MRP-S16, mrps16, RPMS16, RT16_HUMAN, S16mt
This Human MRPS16 protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 38.5 kDa
UniProt: Q9Y3D3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-217AA: 1-137AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.