Human MYL1 protein

Catalog Number: BYT-ORB54533
Article Name: Human MYL1 protein
Biozol Catalog Number: BYT-ORB54533
Supplier Catalog Number: orb54533
Alternative Catalog Number: BYT-ORB54533-20,BYT-ORB54533-100,BYT-ORB54533-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Myosin light chain alkali 1/2
This Human MYL1 protein spans the amino acid sequence from region 1-150aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.7 kDa
UniProt: P05976
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-278AA: 1-150AAFull Length : Full Length of Isoform MLC3
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.