Human ATP5H protein

Catalog Number: BYT-ORB54536
Article Name: Human ATP5H protein
Biozol Catalog Number: BYT-ORB54536
Supplier Catalog Number: orb54536
Alternative Catalog Number: BYT-ORB54536-20,BYT-ORB54536-100,BYT-ORB54536-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ATP synthase D chain mitochondrial, ATP synthase H+ transporting mitochondrial F1F0 subunit, ATP synthase H+ transporting mitochondrial F1F0 subunit d, ATP synthase subunit d, ATP synthase subunit d, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d, ATP5H, ATP5H_HUMAN, ATP5JD, ATPase subunit d, ATPQ, mitochondrial, My032 protein
This Human ATP5H protein spans the amino acid sequence from region 1-161aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 45.4 kDa
UniProt: O75947
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-309AA: 1-161AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.