Human UQCR10 protein

Catalog Number: BYT-ORB54542
Article Name: Human UQCR10 protein
Biozol Catalog Number: BYT-ORB54542
Supplier Catalog Number: orb54542
Alternative Catalog Number: BYT-ORB54542-20,BYT-ORB54542-100,BYT-ORB54542-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7KDA protein Ubiquinol-cytochrome c reductase complex 7.2KDA protein
This Human UQCR10 protein spans the amino acid sequence from region 1-63aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 34.2 kDa
UniProt: Q9UDW1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-317AA: 1-63AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.