Human FBXO2 protein

Catalog Number: BYT-ORB54545
Article Name: Human FBXO2 protein
Biozol Catalog Number: BYT-ORB54545
Supplier Catalog Number: orb54545
Alternative Catalog Number: BYT-ORB54545-20,BYT-ORB54545-100,BYT-ORB54545-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: F box gene 1, F box only protein 2, F box protein 2, F box protein only 2, F-box only protein 2, FBG 1, FBG1, Fbs 1, Fbs1, Fbs2, FBX 2, FBX2, FBX2_HUMAN, FBXO 2, FBXO2, Neural F box protein NFB42 , Neural F-box protein, 42-KD, rat, homolog of, NFB 42, NFB42, OCP1, organ of Corti protein 1, Prpl4
This Human FBXO2 protein spans the amino acid sequence from region 1-296aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 60.3 kDa
UniProt: Q9UK22
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISH
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-126AA: 1-296AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.