human CXCR4 protein

Catalog Number: BYT-ORB54670
Article Name: human CXCR4 protein
Biozol Catalog Number: BYT-ORB54670
Supplier Catalog Number: orb54670
Alternative Catalog Number: BYT-ORB54670-20,BYT-ORB54670-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name, LESTR Lipopolysaccharide-associated protein 3 Short name, LAP-3 Short name, LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name, SDF-1 receptor CD_antigen, CD184
This human CXCR4 protein spans the amino acid sequence from region 1-356aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 56.2 kDa
UniProt: P61073
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFAC
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-541AA: 1-352AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.