human EDNRA protein

Catalog Number: BYT-ORB54681
Article Name: human EDNRA protein
Biozol Catalog Number: BYT-ORB54681
Supplier Catalog Number: orb54681
Alternative Catalog Number: BYT-ORB54681-20,BYT-ORB54681-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Endothelin A receptor
This human EDNRA protein spans the amino acid sequence from region 21-427aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 48.5 kDa
UniProt: P25101
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFY
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: C-terminal 10xHis-tagged: C-terminal 10xHis-tagged27
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.