Fish Salmo salar Vertebrate ancient opsin protein

Catalog Number: BYT-ORB54688
Article Name: Fish Salmo salar Vertebrate ancient opsin protein
Biozol Catalog Number: BYT-ORB54688
Supplier Catalog Number: orb54688
Alternative Catalog Number: BYT-ORB54688-20,BYT-ORB54688-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Vertebrate ancient opsin
This Fish Salmo salar Vertebrate ancient opsin protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.5 kDa
UniProt: O13018
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Salmo salar (Atlantic salmon)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Application Notes: Biological Origin: Salmo salar (Atlantic salmon). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-82AA: 1-75AAPartial: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.