Human APH1a protein

Catalog Number: BYT-ORB54689
Article Name: Human APH1a protein
Biozol Catalog Number: BYT-ORB54689
Supplier Catalog Number: orb54689
Alternative Catalog Number: BYT-ORB54689-20,BYT-ORB54689-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Aph-1alpha Presenilin-stabilization factor
This Human APH1a protein spans the amino acid sequence from region 1-247aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 42.9 kDa
UniProt: Q96BI3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-75AA: 1-247AAPartial: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.