Human ABCB8 protein

Catalog Number: BYT-ORB54691
Article Name: Human ABCB8 protein
Biozol Catalog Number: BYT-ORB54691
Supplier Catalog Number: orb54691
Alternative Catalog Number: BYT-ORB54691-20,BYT-ORB54691-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Mitochondrial ATP-binding cassette 1 Short name, M-ABC1
This Human ABCB8 protein spans the amino acid sequence from region 38-693aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 87 kDa
UniProt: Q9NUT2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GKTGQLHKAEGEYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFLHPHLLVLGVAVVLALGAALVNVQIPLLLGQLVEVVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDITFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLST
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged221-454AA: 38-693AAPartial: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.