Human CLASP2 protein

Catalog Number: BYT-ORB54700
Article Name: Human CLASP2 protein
Biozol Catalog Number: BYT-ORB54700
Supplier Catalog Number: orb54700
Alternative Catalog Number: BYT-ORB54700-20,BYT-ORB54700-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cytoplasmic linker-associated protein 2 Protein Orbit homolog 2 Short name, hOrbit2
This Human CLASP2 protein spans the amino acid sequence from region 1-431aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 60.5 kDa
UniProt: O75122
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-B2M-tagged1-391AA: 1-431AAFull Length : Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.