Human BPIFA1 protein

Catalog Number: BYT-ORB54703
Article Name: Human BPIFA1 protein
Biozol Catalog Number: BYT-ORB54703
Supplier Catalog Number: orb54703
Alternative Catalog Number: BYT-ORB54703-20,BYT-ORB54703-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Lung-specific protein X Nasopharyngeal carcinoma-related protein Palate lung and nasal epithelium clone protein Secretory protein in upper respiratory tracts Short PLUNC1 Short name, SPLUNC1 Tracheal epithelium-enriched protein Von Ebner protein Hl
This Human BPIFA1 protein spans the amino acid sequence from region 20-256aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 40.7 kDa
UniProt: Q9NP55
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-707AA: 20-256AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.