Dog Cationic trypsin protein

Catalog Number: BYT-ORB54712
Article Name: Dog Cationic trypsin protein
Biozol Catalog Number: BYT-ORB54712
Supplier Catalog Number: orb54712
Alternative Catalog Number: BYT-ORB54712-20,BYT-ORB54712-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cationic trypsin, EC 3.4.21.4
This Dog Cationic trypsin protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 39.6 kDa
UniProt: P06871
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Canis lupus familiaris (Dog) (Canis familiaris)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN
Application Notes: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged24-247AA: 24-246AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.