Human RFWD2 protein

Catalog Number: BYT-ORB54714
Article Name: Human RFWD2 protein
Biozol Catalog Number: BYT-ORB54714
Supplier Catalog Number: orb54714
Alternative Catalog Number: BYT-ORB54714-20,BYT-ORB54714-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Constitutive photomorphogenesis protein 1 homolog Short name, hCOP1 RING finger and WD repeat domain protein 2 RING finger protein 200
This Human RFWD2 protein spans the amino acid sequence from region 1-731aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 84.5 kDa
UniProt: Q8NHY2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-tagged26-177AA: 1-731AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.