Mouse Tectb protein

Catalog Number: BYT-ORB54719
Article Name: Mouse Tectb protein
Biozol Catalog Number: BYT-ORB54719
Supplier Catalog Number: orb54719
Alternative Catalog Number: BYT-ORB54719-20,BYT-ORB54719-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Tectb, Beta-tectorin
This Mouse Tectb protein spans the amino acid sequence from region 18-305aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 36.5 kDa
UniProt: O08524
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSE
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-490AA: 18-305AAFull Length : Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.