Viral VACWR090 protein

Catalog Number: BYT-ORB54723
Article Name: Viral VACWR090 protein
Biozol Catalog Number: BYT-ORB54723
Supplier Catalog Number: orb54723
Alternative Catalog Number: BYT-ORB54723-20,BYT-ORB54723-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein F4
This Viral VACWR090 protein spans the amino acid sequence from region 1-350aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.6 kDa
UniProt: P07614
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNH
Application Notes: Biological Origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 6xHis-tagged20-576AA: 1-350AAPartial: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.