Human TLR10 protein

Catalog Number: BYT-ORB54729
Article Name: Human TLR10 protein
Biozol Catalog Number: BYT-ORB54729
Supplier Catalog Number: orb54729
Alternative Catalog Number: BYT-ORB54729-20,BYT-ORB54729-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD_antigen, CD290
This Human TLR10 protein spans the amino acid sequence from region 20-576aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 68.1 kDa
UniProt: Q9BXR5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 10xHis-tagged25-197AA: 20-576AAFull Length : Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.