Viral UL131 protein

Catalog Number: BYT-ORB54731
Article Name: Viral UL131 protein
Biozol Catalog Number: BYT-ORB54731
Supplier Catalog Number: orb54731
Alternative Catalog Number: BYT-ORB54731-20,BYT-ORB54731-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: UL131Uncharacterized protein UL131
This Viral UL131 protein spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.2 kDa
UniProt: P16773
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR
Application Notes: Biological Origin: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged55-338AA: 1-76AAExtracellular Domain: Full length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.