Human UBTF protein

Catalog Number: BYT-ORB54732
Article Name: Human UBTF protein
Biozol Catalog Number: BYT-ORB54732
Supplier Catalog Number: orb54732
Alternative Catalog Number: BYT-ORB54732-20,BYT-ORB54732-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Autoantigen NOR-90 Upstream-binding factor 1 Short name, UBF-1
This Human UBTF protein spans the amino acid sequence from region 1-764aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 93.4 kDa
UniProt: P17480
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 10xHis-SUMO-tagged1-76AA: 1-764AAFull length : Full length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.