Rat Tlr4 protein

Catalog Number: BYT-ORB54736
Article Name: Rat Tlr4 protein
Biozol Catalog Number: BYT-ORB54736
Supplier Catalog Number: orb54736
Alternative Catalog Number: BYT-ORB54736-20,BYT-ORB54736-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD_antigen, CD284
This Rat Tlr4 protein spans the amino acid sequence from region 26-638aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 90.2 kDa
UniProt: Q9QX05
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLC
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: N-terminal 6xHis-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged1-764AA: 26-638AAFull Length : Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.