Mouse Setd4 protein

Catalog Number: BYT-ORB54753
Article Name: Mouse Setd4 protein
Biozol Catalog Number: BYT-ORB54753
Supplier Catalog Number: orb54753
Alternative Catalog Number: BYT-ORB54753-20,BYT-ORB54753-100,BYT-ORB54753-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Setd4, ORF21, SET domain-containing protein 4, EC 2.1.1.-
This Mouse Setd4 protein spans the amino acid sequence from region 1-439aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51.8 kDa
UniProt: P58467
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MQRRRGRTERARKRRRRSSGSRAVNESYRSEFIELRKWLKERKFEDTDLVPASFPGTGRGLMSKASLQEGQVMISLPESCLLTTDTVIRSSLGPYIKKWKPPVSPLLALCTFLVSEKHAGCRSLWKSYLDILPKSYTCPVCLEPEVVDLLPSPLKAKAEEQRARVQDLFTSARGFFSTLQPLFAEPVDSVFSYRAFLWAWCTVNTRAVYLRSRRQECLSAEPDTCALAPFLDLLNHSPHVQVKAAFNEKTRCYEI
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 10xHis-tagged: N-terminal 6xHis-tagged1-727AA: 1-439AAFull Length: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.