Animal TNF protein

Catalog Number: BYT-ORB54762
Article Name: Animal TNF protein
Biozol Catalog Number: BYT-ORB54762
Supplier Catalog Number: orb54762
Alternative Catalog Number: BYT-ORB54762-20,BYT-ORB54762-100,BYT-ORB54762-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2
This Animal TNF protein spans the amino acid sequence from region 57-233aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.2 kDa
UniProt: O35734
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Marmota monax (Woodchuck)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL
Application Notes: Biological Origin: Marmota monax (Woodchuck). Application Notes: N-terminal 10xHis-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged1-200AA: 57-233AAFull Length : Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.