CALR Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB573585
| Article Name: |
CALR Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB573585 |
| Supplier Catalog Number: |
orb573585 |
| Alternative Catalog Number: |
BYT-ORB573585-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Animal, Canine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human CALR |
| Conjugation: |
Unconjugated |
| Alternative Names: |
RO, CRT, SSA, cC1qR, HEL-S-99n |
| Rabbit polyclonal antibody to CALR |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
48kDa |
| NCBI: |
004334 |
| UniProt: |
P27797 |
| Buffer: |
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: FGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDK |
| Target: |
CALR |
