KLF9 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB573770
- Images (7)
| Article Name: | KLF9 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB573770 |
| Supplier Catalog Number: | orb573770 |
| Alternative Catalog Number: | BYT-ORB573770-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLF9 |
| Conjugation: | Unconjugated |
| Alternative Names: | BTEB, BTEB1 |
| Rabbit polyclonal antibody to KLF9 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 27kDa |
| NCBI: | 001197 |
| UniProt: | Q13886 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE |
| Target: | KLF9 |
|
|
Sample Tissue: Human 786-0, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Fetal Liver lysates, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml. |
|
|
Rabbit Anti-KL9 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Testis |
|
|
WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat. |
Product Guarantee and Expert Support
