CHEK1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574279
- Images (7)
| Article Name: | CHEK1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB574279 |
| Supplier Catalog Number: | orb574279 |
| Alternative Catalog Number: | BYT-ORB574279-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human CHEK1 |
| Conjugation: | Unconjugated |
| Alternative Names: | CHK1 |
| Rabbit polyclonal antibody to CHEK1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 54kDa |
| NCBI: | 001265 |
| UniProt: | O14757 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF |
| Target: | CHEK1 |
|
|
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. CHEK1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml. |
|
|
Lane 1: 40 ug SH-SY5Y lysate, Lane 2: 40 ug SH-SY5Y lysate, Lane 3: 40 ug HEK293T lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:8000, Gene Name: CHEK1. |
|
|
Rabbit Anti-CHEK1 antibody, Catalog Number: orb574279, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
WB Suggested Anti-CHEK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine. |
Product Guarantee and Expert Support
