ACSL1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574384
- Images (7)
| Article Name: | ACSL1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB574384 |
| Supplier Catalog Number: | orb574384 |
| Alternative Catalog Number: | BYT-ORB574384-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human ACSL1 |
| Conjugation: | Unconjugated |
| Alternative Names: | ACS1, LACS, FACL1, FACL2, LACS1, LACS2 |
| Rabbit polyclonal antibody to ACSL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 78kDa |
| NCBI: | 001986 |
| UniProt: | P33121 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG |
| Target: | ACSL1 |
|
|
ACSL1 antibody - C-terminal region (orb574384), Catalog Number: orb574384, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
|
|
heart, liver, pancreas, brain. |
|
|
Hum. Fetal Brain. |
|
|
Human 721_B cells. ACSL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Human Hela |
|
|
Human kidney |
|
|
WB Suggested Anti-ACSL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
