TBX20 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574547
- Images (7)
| Article Name: | TBX20 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB574547 |
| Supplier Catalog Number: | orb574547 |
| Alternative Catalog Number: | BYT-ORB574547-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human TBX20 |
| Conjugation: | Unconjugated |
| Alternative Names: | ASD4 |
| Rabbit polyclonal antibody to TBX20 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 49kDa |
| NCBI: | 065150 |
| UniProt: | Q9UMR3 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS |
| Target: | TBX20 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 2 ug/ml. |
|
|
Sample Tissue: Human HepG2, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Jurkat cell lysates, Antibody dilution: 1.0 ug/ml. |
|
|
Human Muscle |
|
|
Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-TBX20 antibody (orb574547). |
|
|
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown. |
Product Guarantee and Expert Support
