ADPGK Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB575175
- Images (7)
| Article Name: | ADPGK Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB575175 |
| Supplier Catalog Number: | orb575175 |
| Alternative Catalog Number: | BYT-ORB575175-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human ADPGK |
| Conjugation: | Unconjugated |
| Alternative Names: | ADP-GK, 2610017G09Rik |
| Rabbit polyclonal antibody to ADPGK |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 54kDa |
| NCBI: | 112574 |
| UniProt: | Q9BRR6 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV |
| Target: | ADPGK |
|
|
Sample Type: 293T, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in HEK293T. |
|
|
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in MCF7. |
|
|
WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate, ADPGK is supported by BioGPS gene expression data to be expressed in COLO205. |
Product Guarantee and Expert Support
