Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV
Target:
ADPGK
Sample Type: 293T, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in HEK293T.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in HeLa.
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. ADPGK is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate, ADPGK is supported by BioGPS gene expression data to be expressed in COLO205.
* VAT and and shipping costs not included. Errors and price changes excepted