GJA4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB576029
- Images (7)
| Article Name: | GJA4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB576029 |
| Supplier Catalog Number: | orb576029 |
| Alternative Catalog Number: | BYT-ORB576029-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human GJA4 |
| Conjugation: | Unconjugated |
| Alternative Names: | CX37 |
| Rabbit polyclonal antibody to GJA4 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 37 kDa |
| NCBI: | 002051 |
| UniProt: | P35212 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA |
| Target: | GJA4 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. |
|
|
Rabbit Anti-GJA4 Antibody, Catalog Number: orb576029, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells and macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
|
|
WB Suggested Anti-GJA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. GJA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
Product Guarantee and Expert Support
