MUC1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB578068
Article Name: MUC1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB578068
Supplier Catalog Number: orb578068
Alternative Catalog Number: BYT-ORB578068-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Porcine
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1
Conjugation: Unconjugated
Alternative Names: EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227, H23AG, MCKD1, MUC-1, ADMCKD, ADTKD2, ADMCKD1, CA 15-3, MUC-1/X, MUC1/ZD, MUC-1/SEC
Rabbit polyclonal antibody to MUC1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 22kDa
NCBI: 001037855
UniProt: Q7Z552
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL
Target: MUC1
Sample Type: HepG2 Whole cell lysates, Antibody Dilution: 1.0 ug/ml.
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
NMuFG cells in ImmunohistochemistryDilutions 1:50 for the three primary antibodies and 1:100 for FITC-conjugated secondary.
Rabbit Anti-MUC1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Sample Type: Human stomach, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
Sample Type: Pig stomach, Primary Antibody Dilution: 1:5000 + 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
Sample Type: Pig stomach, Primary Antibody Dilution: 1:5000 + 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.