F2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB578202
- Images (7)
| Article Name: | F2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB578202 |
| Supplier Catalog Number: | orb578202 |
| Alternative Catalog Number: | BYT-ORB578202-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human F2 |
| Conjugation: | Unconjugated |
| Alternative Names: | PT, THPH1, RPRGL2 |
| Rabbit polyclonal antibody to F2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 70 kDa |
| NCBI: | 000497 |
| UniProt: | P00734 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
| Target: | F2 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is processed to prothrombin and the peptide also is contained in the b-chain form of ~30 kDa as well as a 32 kDa form of prothrombin. Peptide aligns to amino acids 419-432 kDa in the full length form. |
|
|
Anti-F2 / Thrombin antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
|
Anti-F2 / Thrombin antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml. |
|
|
Rabbit Anti-F2 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/ml. |
|
|
WB Suggested Anti-F2 Antibody, Titration: 1 ug/ml, Positive Control: 721_B cell lysate. |
Product Guarantee and Expert Support
