F2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB578202
Article Name: F2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB578202
Supplier Catalog Number: orb578202
Alternative Catalog Number: BYT-ORB578202-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human F2
Conjugation: Unconjugated
Alternative Names: PT, THPH1, RPRGL2
Rabbit polyclonal antibody to F2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 70 kDa
NCBI: 000497
UniProt: P00734
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
Target: F2
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is processed to prothrombin and the peptide also is contained in the b-chain form of ~30 kDa as well as a 32 kDa form of prothrombin. Peptide aligns to amino acids 419-432 kDa in the full length form.
Anti-F2 / Thrombin antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-F2 / Thrombin antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
Rabbit Anti-F2 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/ml.
WB Suggested Anti-F2 Antibody, Titration: 1 ug/ml, Positive Control: 721_B cell lysate.