Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN
Target:
ATP6V0A2
Anti-ATP6V0A2 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-ATP6V0A2 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Application: IHC/Immunofluorescence, Species+tissue/cell type: A. untransfected HeLa cells, B. mATP6V0A2-FLAG transfected HeLa cells, C. mATP6V0A2 (partial) transfected HeLa cells, Primary antibody dilution: 1:250, Secondary antibody: Anti-rabbit AlexaFluor 488, Secondary antibody dilution: 1:1000.
Application: Western blotting, Species+tissue/cell type: HeLa cells, How many ugsof tissue/cell lysate run on the gel: 1. 10 ug untransfected HeLa lysate, 2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate, 3. 10 ug mATP6V0A2-FLAG transfected HeLa lysate, 4. 10 ug mATP6V0A1-FLAG transfected HeLa lysate, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-HRP, Secondary antibody dilution: 1:1000.
ATP6V0A2 antibody - N-terminal region (orb578447) validated by WB using HeLa cells at 1:300.
Positive control (+): MCF7 (N10), Negative control (-): HEK293 (HEK293), Antibody concentration: 1 ug/ml.
Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody (orb578447).
* VAT and and shipping costs not included. Errors and price changes excepted
