Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF
Target:
UBE2D3
Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Lanes: 1: 40 ng HIS-UBE2D1 protein, 2: 40 ng HIS-UBE2D2 protein, 3: 40 ng HIS-UBE2D3 protein, 4: 40 ng HIS-UBE2D4 protein, 5: 40 ng HIS-UBE2E1 protein, 6: 40 ng HIS-UBE2E2 protein, 7: 40 ng HIS-UBE2E3 protein, 8: 40 ng HIS-UBE2K protein, 9: 40 ng HIS-UBE2L3 protein, 10: 40 ng HIS-UBE2N protein, 11: 40 ng HIS-UBE2V1 protein, 12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:50000, Gene Name: UBE2D3.
WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
* VAT and and shipping costs not included. Errors and price changes excepted
