ATP6V0C Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB579396
- Images (7)
| Article Name: | ATP6V0C Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB579396 |
| Supplier Catalog Number: | orb579396 |
| Alternative Catalog Number: | BYT-ORB579396-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0C |
| Conjugation: | Unconjugated |
| Alternative Names: | ATPL, VATL, VPPC, Vma3, ATP6C, ATP6L |
| Rabbit polyclonal antibody to ATP6V0C |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 16 kDa |
| NCBI: | 001685 |
| UniProt: | P27449 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG |
| Target: | ATP6V0C |
|
|
25 ug of the indicated whole cell extracts was loaded onto a 10-20% gradient SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended antibody dilution is 1 ug/ml to 3 ug/ml. |
|
|
Sample Tissue: Human COLO205 Whole Cell, Antibody Dilution: 3 ug/ml. |
|
|
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Type: ACHN, Antibody Dilution: 1.0 ug/ml. ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells. |
|
|
Sample Type: Human Lung, Antibody Dilution: 1.0 ug/ml. |
|
|
Positive control (+): RPMI-8226 (N12), Negative control (-): U937 (N31), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-ATP6V0C Antibody Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate. ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in OVCAR3. |
Product Guarantee and Expert Support
