HPRT1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB580413
- Images (7)
| Article Name: | HPRT1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB580413 |
| Supplier Catalog Number: | orb580413 |
| Alternative Catalog Number: | BYT-ORB580413-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human HPRT1 |
| Conjugation: | Unconjugated |
| Alternative Names: | HPRT, HGPRT |
| Rabbit polyclonal antibody to HPRT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 25 kDa |
| NCBI: | 000185 |
| UniProt: | P00492 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
| Target: | HPRT1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
WB Suggested Anti-HPRT1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. HPRT1 is supported by BioGPS gene expression data to be expressed in HeLa. |
Product Guarantee and Expert Support
