RHBDF1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB580834
- Images (7)
| Article Name: | RHBDF1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB580834 |
| Supplier Catalog Number: | orb580834 |
| Alternative Catalog Number: | BYT-ORB580834-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDF1 |
| Conjugation: | Unconjugated |
| Alternative Names: | Dist1, hDist1, C16orf8, EGFR-RS, gene-89, gene-90 |
| Rabbit polyclonal antibody to RHBDF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 97 kDa |
| NCBI: | 071895 |
| UniProt: | Q96CC6 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR |
| Target: | RHBDF1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms present from ~95 kDa to ~80 kda and another isoform is present ~54 kDa. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12. |
|
|
Positive control (+): Human stomach (ST), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-RHBDF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. |
Product Guarantee and Expert Support
