PORCN Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB580851
Article Name: PORCN Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB580851
Supplier Catalog Number: orb580851
Alternative Catalog Number: BYT-ORB580851-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PORCN
Conjugation: Unconjugated
Alternative Names: PPN, DHOF, FODH, MG61, PORC
Rabbit polyclonal antibody to PORCN
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 52 kDa
NCBI: 073736
UniProt: Q9H237
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF
Target: PORCN
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.
Sample Type: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.
Positive control (+): Human lung (LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
Immunohistochemistry, Sample type: Mouse Uterus, - primary antibody dilution 1 in 300, - secondary antibody dilution 1 in 1000.
WB Suggested Anti-PORCN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.