PORCN Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB580851
- Images (7)
| Article Name: | PORCN Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB580851 |
| Supplier Catalog Number: | orb580851 |
| Alternative Catalog Number: | BYT-ORB580851-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human PORCN |
| Conjugation: | Unconjugated |
| Alternative Names: | PPN, DHOF, FODH, MG61, PORC |
| Rabbit polyclonal antibody to PORCN |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 52 kDa |
| NCBI: | 073736 |
| UniProt: | Q9H237 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF |
| Target: | PORCN |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%. |
|
|
Positive control (+): Human lung (LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml. |
|
|
Immunohistochemistry, Sample type: Mouse Uterus, - primary antibody dilution 1 in 300, - secondary antibody dilution 1 in 1000. |
|
|
WB Suggested Anti-PORCN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
