DNM1L Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB581671
- Images (7)
| Article Name: | DNM1L Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB581671 |
| Supplier Catalog Number: | orb581671 |
| Alternative Catalog Number: | BYT-ORB581671-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human DNM1L |
| Conjugation: | Unconjugated |
| Alternative Names: | DLP1, DRP1, DVLP, EMPF, OPA5, EMPF1, DYMPLE, HDYNIV |
| Rabbit polyclonal antibody to DNM1L |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 82 kDa |
| NCBI: | 036192 |
| UniProt: | O00429 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG |
| Target: | DNM1L |
|
|
Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000. |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at ~79-80 kDa. |
|
|
Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Positive control (+): A549 (N03), Negative control (-): HepG2 (HG), Antibody concentration: 3 ug/ml. |
|
|
Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000. |
|
|
WB Suggested Anti-DNM1L Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. DNM1L is supported by BioGPS gene expression data to be expressed in HeLa. |
Product Guarantee and Expert Support
