FGF21 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB582731
- Images (7)
| Article Name: | FGF21 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB582731 |
| Supplier Catalog Number: | orb582731 |
| Alternative Catalog Number: | BYT-ORB582731-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human FGF21 |
| Conjugation: | Unconjugated |
| Rabbit polyclonal antibody to FGF21 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 22kDa |
| NCBI: | 061986 |
| UniProt: | Q9NSA1 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT |
| Target: | FGF21 |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: 293T Whole Cell lysates, Antibody dilution: 0.5 ug/ml. |
|
|
Liver |
|
|
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown. |
|
|
WB Suggested Anti-FGF21 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. |
Product Guarantee and Expert Support
